PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04799.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 427aa    MW: 47065.3 Da    PI: 6.435
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04799.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc04799.1.g00030.1.sm.mk 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                                  678*******************************************97 PP

2Myb_DNA-binding47.15.6e-1567110146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg++++eE++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Zmw_sc04799.1.g00030.1.sm.mk  67 RGAFSQEEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                                   89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.6961IPR017930Myb domain
SuperFamilySSF466891.26E-2912108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001672.75E-111761No hitNo description
PROSITE profilePS5129425.61562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007175.8E-1366114IPR001005SANT/Myb domain
PfamPF002499.2E-1467110IPR001005SANT/Myb domain
CDDcd001676.67E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLA EADRSGAAPT NSAERTSGSS DANPSSNGAL GNLSHLLSET AQSSMLLPVY  180
DKNRAETPNF ARPKVPPKEL FLDQLSAGHE SPSTCRSSGP TLYFPFQQPL GYSSESGSGD  240
GANMNSLWFN QSDFNCSTIS TAMPPVSPSA LSTSVGLNLP QDNPRHGVTG IGSASVDSFY  300
WDGTNPSSSS STGSRGNNSM GFEPQSTSSI LDSSVFPWTD IGQEKDTRGH LVEELKWPEL  360
LHGNFAETTT AMQNQSQSLY DDVIKAESQF NMEGICASWF QNQQQLQAAP DMYDKDLQRM  420
QLSFENI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132070.10.0MYB transcription factor
TrEMBLB4FF630.0B4FF63_MAIZE; MYB transcription factor
STRINGGRMZM2G127490_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794